PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G168200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family WOX
Protein Properties Length: 218aa    MW: 25308.9 Da    PI: 8.4559
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G168200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.21.8e-20666257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       ++R+++t+eql +Lee+++   ++p+a+++++++++l    +++ ++V++WFqN++a++++
  Aqcoe2G168200.1.p  6 STRWCPTPEQLMILEEMYRGgIKTPNATQIQQITAHLslygKIEGKNVFYWFQNHKARDRQ 66
                       58*****************99*************************************996 PP

2Wus_type_Homeobox1192.1e-38567264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       a+tRW+PtpeQ++iLee+y+ G++tPn+ +iq+ita+L+ yGkie+kNVfyWFQN+kaR+rqk
  Aqcoe2G168200.1.p  5 ASTRWCPTPEQLMILEEMYRGGIKTPNATQIQQITAHLSLYGKIEGKNVFYWFQNHKARDRQK 67
                       689***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.928267IPR001356Homeobox domain
SMARTSM003892.6E-5471IPR001356Homeobox domain
PfamPF000463.8E-18766IPR001356Homeobox domain
SuperFamilySSF466895.56E-11767IPR009057Homeodomain-like
CDDcd000867.36E-5767No hitNo description
Gene3DG3DSA:1.10.10.601.6E-7866IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MSPAASTRWC PTPEQLMILE EMYRGGIKTP NATQIQQITA HLSLYGKIEG KNVFYWFQNH  60
KARDRQKLRR KLCRQQQQQL QHLVQPTYHH HHLFNHLEAS TSLGLQPFHP YYSTSLQWFP  120
QEGLLEEASN QVINNTKKMD NFYVEAEMDK WMKIYGNYAT DYTMMMDVAQ EVPPCCINST  180
KPLKTLELFP IKSTTSFRDE CSTSKSLITS STMATNY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010259966.13e-71PREDICTED: WUSCHEL-related homeobox 3-like
SwissprotQ9SIB45e-46WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLA5AKT82e-60A5AKT8_VITVI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.14e-39WOX family protein